PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA033733-PA
Common NameILI2, OsI_36643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bHLH
Protein Properties Length: 77aa    MW: 8396.73 Da    PI: 5.0364
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA033733-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH27.65.1e-093391854
                      HHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
               HLH 18 safeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                      + +++L+ +lP++ ++ + K s ae+L++A++YI+ L
  BGIOSGA033733-PA  3 ELISKLQAVLPTRGGEANAKASSAEVLQEACRYIRRL 39
                      789*********88*********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.553139IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474594.32E-8255IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000106.2E-6339IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.0E-7353IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MAELISKLQA VLPTRGGEAN AKASSAEVLQ EACRYIRRLH READALSERL AELLLLQPSD  60
LAINGADVPD LIRSLLM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8332021e-128CT833202.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA029D09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616701.11e-47PREDICTED: transcription factor ILI2 isoform X2
SwissprotB8BLA32e-47ILI2_ORYSI; Transcription factor ILI2
SwissprotQ2R1J32e-47ILI2_ORYSJ; Transcription factor ILI2
TrEMBLA0A0E0BKZ76e-48A0A0E0BKZ7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA033733-PA4e-47(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170041112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-08bHLH family protein